PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00701g00031.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 825aa    MW: 91052 Da    PI: 7.2674
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00701g00031.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.76.3e-0985127347
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               +WT +E+e++  a +q G++ +++I ++++  +   q++++++ +
  Peaxi162Scf00701g00031.1  85 AWTRQEEERFFSALRQVGKN-FERITSRVQ-SKNKDQVRHYYYRL 127
                               6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.36E-1080132IPR009057Homeodomain-like
PROSITE profilePS5129313.12281132IPR017884SANT domain
SMARTSM007171.1E-682130IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.2E-684130IPR009057Homeodomain-like
PfamPF002491.1E-685127IPR001005SANT/Myb domain
CDDcd001674.67E-685128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 825 aa     Download sequence    Send to blast
MQIEPRASLE CETSLHPVTF MCKDGSSGFT QEPVAAQLVI PSKGHPASQQ SVPTHDHVVT  60
QQVPSSQDQV TLQQPAKRQT RQWAAWTRQE EERFFSALRQ VGKNFERITS RVQSKNKDQV  120
RHYYYRLVRR MNKLLGPELS LDAKNSKDTN AAMLRWWSLL EKSSCKASQL HLKPRRFKIF  180
IETLESQLLK DRKKKIRRRP SQGESSSVAA ESLSSHSRVS THDSQAVKVV LLDNQDIQKF  240
GSGKGSSLKR HVTMGVNRRN AKVDSSPVKN ARHRRRIGSA SKAAFKKWEK AAIAGVSLVA  300
DAAEHLERAT IDKDVGLVQN SQGEHLGLNC FEHVGKDVHS LPTLSQNLFN ETNIQSCMKL  360
KLQLFPVDEG TRRALEMDNH NPYLELTLSN RKKMSSVLEH LNRKWGSSSI ATGELVLFPY  420
HVPMENLVQS LRWTKDTTLS AADVYNLIGS PPVFRLRYGW FPNAELGTSR APLSSITPFS  480
QNTNTNITEE KNAEVLTSSN GKLVHFAKEP LVSNPRTTVT SSSIELSGES NFQVSMGLNT  540
HCSGHDETLP SHRRENGAAT AGKQVEVHDM LGNKASALLA GGWEDSITIS IGDLLSDAPD  600
DEEANGIDST LPGSSNFFQQ NPFSCDSFDA AIAAHIYKHR SKADSQMVLP PQSSSIWNAE  660
DTCDAFSFLK DLASSDKARS PSSNVCGENW QQIARSSSLV LDAGVKDLPG NVEPLIDEAA  720
HIDPTDECQS NARALDGSSK ELNELSDIYW SDSLGPLELD APSCRYHNED LILGDSRGCL  780
NRLIASSLDA FQNCSFFGVD KKEPGSTAEA LEASSFSDCK IGAKV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1190199DRKKKIRRRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009610182.10.0PREDICTED: TSL-kinase interacting protein 1 isoform X1
RefseqXP_009610183.10.0PREDICTED: TSL-kinase interacting protein 1 isoform X1
SwissprotQ8LJT80.0TKI1_ARATH; TSL-kinase interacting protein 1
TrEMBLK4CQJ90.0K4CQJ9_SOLLC; Uncharacterized protein
STRINGSolyc09g008100.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA86401719
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.30.0TSL-kinase interacting protein 1